PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6KG359100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 299aa    MW: 32615.8 Da    PI: 8.9859
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6KG359100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.26.8e-121863146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                         +g+W +eEde l + v+++G++ W++I ++  + Rt+k+c++rw +
  Pavir.6KG359100.1.p 18 KGPWKAEEDEVLRRHVREHGPREWSSIRSKGLLPRTGKSCRLRWVN 63
                         79*************************8876677**********87 PP

2Myb_DNA-binding42.12e-1374114345
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          ++++eE+   +d+ +q G++ W++Ia +++ gRt++++k++w 
  Pavir.6KG359100.1.p  74 KFSAEEERVVIDLQAQIGNK-WARIATYLP-GRTDNDVKNFWS 114
                          79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.0421369IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-201366IPR009057Homeodomain-like
SuperFamilySSF466898.98E-2716113IPR009057Homeodomain-like
SMARTSM007172.4E-101767IPR001005SANT/Myb domain
CDDcd001671.74E-112065No hitNo description
PfamPF139217.3E-112171No hitNo description
Gene3DG3DSA:1.10.10.606.4E-1867119IPR009057Homeodomain-like
PROSITE profilePS5129416.99370121IPR017930Myb domain
SMARTSM007179.0E-1171119IPR001005SANT/Myb domain
CDDcd001671.65E-974113No hitNo description
PfamPF002492.8E-1174114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MKPRGGRGGG GEQPAVRKGP WKAEEDEVLR RHVREHGPRE WSSIRSKGLL PRTGKSCRLR  60
WVNKLRPDLK TGCKFSAEEE RVVIDLQAQI GNKWARIATY LPGRTDNDVK NFWSTRQKRL  120
ARLLRAPVPR RRPGKQNCSA ASSHAHELPT KQNLCLDMIP FQATTTPAHH TGESSSHDPR  180
AASQHRPGDA PFPGAHDLPP PPVPPLTHAG AAPTASAPAF LPYDGDYYAG DAVAGVDPLV  240
FVDPAACPEP LAVVPPGTFF GLDDDYVHGG RVLHPASSGV RFDDLPPETF DFFELPQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251411923126MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1410GGRGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445870.13e-97hypothetical protein SORBIDRAFT_07g027160
TrEMBLK3YNH41e-147K3YNH4_SETIT; Uncharacterized protein
STRINGSi015815m1e-147(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.17e-60MYB family protein